Yan-Mei Li

Find an error

Name: 李艳梅; Li, YanMei
Organization: Tsinghua University , China
Department: Department of Chemistry
Title: Professor(PhD)
Co-reporter:Qian-Qian Li;Pu-Guang Chen;Zhi-Wen Hu;Yuan Cao;Liang-Xiao Chen;Yong-Xiang Chen;Yu-Fen Zhao
Chemical Science (2010-Present) 2017 vol. 8(Issue 11) pp:7675-7681
Publication Date(Web):2017/10/23
DOI:10.1039/C7SC03217J
The selective killing of cancer cells and the avoidance of drug resistance are still difficult challenges in cancer therapy. Here, we report a new strategy that uses enzyme-induced gain of function (EIGF) to regulate the structure and function of phosphorylated melittin analogues (MelAs). Original MelAs have the capacity to disrupt plasma membranes and induce cell death without selectivity. However, phosphorylation of Thr23 on one of the MelAs (MelA2-P) efficiently ameliorated the membrane lysis potency as well as the cytotoxicity for normal mammalian cells. After treatment with alkaline phosphatase (ALP), which is more active in cancer cells than normal cells, MelA2-P restored the pore-forming function around the cancer cells and induced cancer cell death selectively. This mechanism was independent of the receptor proteins and the cell uptake process, which may partially bypass the development of drug resistance in cancer cells.
Co-reporter:Na Gao;Ting-Ting Chu;Qian-Qian Li;Yeh-Jun Lim;Tian Qiu;Meng-Rong Ma;Zhi-Wen Hu;Xi-Fei Yang;Yong-Xiang Chen;Yu-Fen Zhao
RSC Advances (2011-Present) 2017 vol. 7(Issue 64) pp:40362-40366
Publication Date(Web):2017/08/16
DOI:10.1039/C7RA05347A
Tau reduction is a favorable strategy for Alzheimer's disease (AD) treatment. In this work, we designed and synthesized a hydrophobic tag conjugated peptide (HyT-Tau-CPP) to selectively promote the degradation of Tau. HyT-Tau-CPP could potently lower the Tau level in a concentration- and time-dependent manner. Furthermore, HyT-Tau-CPP could also reduce the level of Tau in the brain of AD mouse models. Therefore, Tau reduction by HyT-Tau-CPP may become a potential therapeutic strategy in the treatment for AD.
Co-reporter:Na Gao;Ting-Ting Chu;Qian-Qian Li;Yeh-Jun Lim;Tian Qiu;Meng-Rong Ma;Zhi-Wen Hu;Xi-Fei Yang;Yong-Xiang Chen;Yu-Fen Zhao
RSC Advances (2011-Present) 2017 vol. 7(Issue 64) pp:40362-40366
Publication Date(Web):2017/08/16
DOI:10.1039/C7RA05347A
Tau reduction is a favorable strategy for Alzheimer's disease (AD) treatment. In this work, we designed and synthesized a hydrophobic tag conjugated peptide (HyT-Tau-CPP) to selectively promote the degradation of Tau. HyT-Tau-CPP could potently lower the Tau level in a concentration- and time-dependent manner. Furthermore, HyT-Tau-CPP could also reduce the level of Tau in the brain of AD mouse models. Therefore, Tau reduction by HyT-Tau-CPP may become a potential therapeutic strategy in the treatment for AD.
Co-reporter:Z. Y. Sun, P. G. Chen, Y. F. Liu, B. D. Zhang, J. J. Wu, Y. X. Chen, Y. F. Zhao and Y. M. Li  
Chemical Communications 2016 vol. 52(Issue 48) pp:7572-7575
Publication Date(Web):17 May 2016
DOI:10.1039/C6CC02000C
Novel multi-component self-assembled nano-vaccines containing both Pam3CSK4 and CpG were developed for the first time. These multi-component vaccines could effectively activate the macrophages in vitro and elicit strong antibody immune responses and anti-tumor immune responses in vivo.
Co-reporter:Lan-lan Yu
The Journal of Physical Chemistry C 2016 Volume 120(Issue 12) pp:6577-6582
Publication Date(Web):March 3, 2016
DOI:10.1021/acs.jpcc.5b12357
Glycosylation not only plays a functional role in biological events, but also significantly affects physicochemical properties of proteins. Glycoprotein MUC1 with a variable number of tandem repeats (VNTRs) serves as a promising target for immunotherapy of epithelial cancer. Herein, we synthesized the pristine VNTR and glycosylated VNTR with T antigen functionalized Thr9 and Tn antigen modified Ser15, involving both disaccharide and monosaccharide. The pristine peptides and glycopeptides are observed to form homogeneous assemblies on the highly oriented pyrolytic graphite surfaces by using scanning tunneling microscopy. These peptide assemblies down to the molecular level demonstrate pronounced site-specific instability induced by glycosylation on graphite surface. Moreover, it can be recognized that disaccharide exerts greater influence on the stability of peptide assemblies than monosaccharide. These results could contribute to the structural insights of glycoprotein and pertinent design of biological applications.
Co-reporter:De-Sheng Zhao, Yong-Xiang Chen and Yan-Mei Li  
Chemical Communications 2015 vol. 51(Issue 11) pp:2095-2098
Publication Date(Web):15 Dec 2014
DOI:10.1039/C4CC06739H
Developing compounds regulating amyloid toxic oligomer but not fibril formation should constitute an effective strategy for the treatment of diabetes. Based on the full understanding of the folding mechanism, we designed an orthosteric helix regulator that can promote hIAPP to assemble into large non-cytotoxic oligomers. As a result, the islet cells were protected.
Co-reporter:Yan-Fang Liu, Zhan-Yi Sun, Pu-Guang Chen, Zhi-Hua Huang, Yue Gao, Lei Shi, Yu-Fen Zhao, Yong-Xiang Chen, and Yan-Mei Li
Bioconjugate Chemistry 2015 Volume 26(Issue 8) pp:1439
Publication Date(Web):June 24, 2015
DOI:10.1021/acs.bioconjchem.5b00150
Antitumor vaccine, which is promising for tumor therapy, has been extensively studied. Some encouraging results of chemically synthetic vaccine designs based on the tumor-associated antigen mucin 1 have been achieved. However, some shortcomings such as low efficiency and difficult purification restrict their clinical application. To overcome these difficulties, we designed a novel antitumor vaccine of glycopeptide nanoconjugates based on the multilayer self-assembly through the interaction of positive and negative charges. This vaccine formed the spherical structure and effectively activated the macrophage in vitro. Besides, it also induced high titer of antibodies against mucin 1 glycopeptide. The induced antibodies could highly bind to the tumor cells and effectively kill them by activation of the complement dependent cytotoxicity complex. This novel strategy provides a new way for the development of simple and effective antitumor vaccine.
Co-reporter:Ting-Ting Chu, Qian-Qian Li, Tian Qiu, Zhan-Yi Sun, Zhi-Wen Hu, Yong-Xiang Chen, Yu-Fen Zhao and Yan-Mei Li  
Molecular BioSystems 2014 vol. 10(Issue 12) pp:3081-3085
Publication Date(Web):26 Sep 2014
DOI:10.1039/C4MB00508B
Promoting clearance of intracellular excessive tau is a potential therapeutic strategy for treating Alzheimer's disease. In this work, we designed and synthesized a cyclen-hybrid artificial ‘hydrolase’ I1-Cu(II) to cleave tau in vitro. Furthermore, a cell-permeable ‘hydrolase’ I2-Cu(II), derived from I1-Cu(II), was also synthesized to cleave intracellular tau proteins.
Co-reporter:Qian-Qian Li;Ting-Ting Chu;Yong-Xiang Chen
Chinese Journal of Chemistry 2014 Volume 32( Issue 10) pp:964-968
Publication Date(Web):
DOI:10.1002/cjoc.201400469

Abstract

Neurofibrillary tangles composed of tau protein and senile plaque accumulated by amyloid-β (Aβ) are two hallmarks in Alzheimer disease (AD). In the patients with AD, tau is abnormally hyperphosphorylated, mutated or misfolding, which endows tau with stronger tendency to aggregate. Tau protein has the potency to mediate neuron toxicity of Aβ. The reduction of tau level ameliorates degeneration of neuron axon. Therefore, many researches are exploring new methods to regulate tau level. This review will mainly focus on small molecules that can directly inhibit tau fibrillation or control tau accumulation by regulating tau phosphorylation process.

Co-reporter:Dr. Hui Cai;Zhan-Yi Sun;Mei-Sha Chen;Dr. Yu-Fen Zhao;Dr. Horst Kunz;Dr. Yan-Mei Li
Angewandte Chemie International Edition 2014 Volume 53( Issue 6) pp:1699-1703
Publication Date(Web):
DOI:10.1002/anie.201308875

Abstract

Multivalent synthetic vaccines were obtained by solid-phase synthesis of tumor-associated MUC1 glycopeptide antigens and their coupling to a Pam3Cys lipopeptide through click reactions. These vaccines elicited immune responses in mice without the use of any external adjuvant. The vaccine containing four copies of a MUC1 sialyl-TN antigen showed a significant cluster effect. It induced in mice prevailing IgG2a antibodies, which bind to MCF-7 breast tumor cells and initiate the killing of these tumor cells by activation of the complement-dependent cytotoxicity complex.

Co-reporter:Yue Gao;Zhan-Yi Sun;Zhi-Hua Huang;Pu-Guang Chen;Dr. Yong-Xiang Chen;Dr. Yu-Fen Zhao ;Dr. Yan-Mei Li
Chemistry - A European Journal 2014 Volume 20( Issue 42) pp:13541-13546
Publication Date(Web):
DOI:10.1002/chem.201404013

Abstract

A novel noncovalent strategy to construct chemically synthesized vaccines has been designed to trigger a robust immune response and to dramatically improve the efficiency of vaccine preparation. Glycosylated MUC1 tripartite vaccines were constructed through host–guest interactions with cucurbit[8]uril. These vaccines elicited high levels of IgG antibodies that were recognized by transformed cells and induced the secretion of cytokines. The antisera also mediated complement-dependent cytotoxicity. This noncovalent strategy with good suitability, scalability, and feasibility can be applied as a universal strategy for the construction of chemically synthesized vaccines.

Co-reporter:Mei-Sha Chen, De-Sheng Zhao, Ye-Ping Yu, Wei-Wei Li, Yong-Xiang Chen, Yu-Fen Zhao and Yan-Mei Li  
Chemical Communications 2013 vol. 49(Issue 18) pp:1799-1801
Publication Date(Web):02 Nov 2012
DOI:10.1039/C2CC33432A
The differences in the C-terminal domains of human amylin peptide variants initiate different aggregation processes and differences in the composition of the aggregates by affecting the hydrophobic cores, conformations, and intra-sheet interactions of the peptides, which have distinct effects on the cytotoxicity of the peptides.
Co-reporter:Lei Zhao, Zhi-Wen Hu, Pei Tong, Yong-Xiang Chen, Yu-Fen Zhao, Yan-Mei Li
Bioorganic & Medicinal Chemistry Letters 2013 Volume 23(Issue 9) pp:2727-2732
Publication Date(Web):1 May 2013
DOI:10.1016/j.bmcl.2013.02.071
HIV entry is mediated by the envelope glycoproteins gp120 and gp41. The gp41 subunit contains several functional domains: the N-terminal heptad repeat (NHR) domains fold a triple stranded coiled-coil forming a meta-stable prefusion intermediate. C-terminal heptad repeat (CHR) subsequently folds onto the hydrophobic grooves of the NHR coiled-coil to form a stable 6-helix bundle, which juxtaposes the viral and cellular membranes for fusion. The C34 which has 34 amino acid residues is known as the core structure in CHR. A highly anti-HIV peptide inhibitor derived from C34 was designed. An artificial salt bridge was added in the 6-helical bundle by substitution of lysine for Ile646. With a cholesterol modification at C-terminal, the inhibitor containing I646K mutation represented higher anti-viral activity than C34–cholesterol combination without mutation.A salt bridge was added in the 6-helical bundle by substitution of lysine for Ile646. The new inhibitor has been tested for antiviral activity.
Co-reporter:Dr. Hui Cai;Mei-Sha Chen;Zhan-Yi Sun;Dr. Yu-Fen Zhao;Dr. Horst Kunz;Dr. Yan-Mei Li
Angewandte Chemie International Edition 2013 Volume 52( Issue 23) pp:6106-6110
Publication Date(Web):
DOI:10.1002/anie.201300390
Co-reporter:Dr. Hui Cai;Zhan-Yi Sun;Zhi-Hua Huang;Lei Shi;Dr. Yu-Fen Zhao;Dr. Horst Kunz;Dr. Yan-Mei Li
Chemistry - A European Journal 2013 Volume 19( Issue 6) pp:1962-1970
Publication Date(Web):
DOI:10.1002/chem.201203709

Abstract

Glycopeptides of tumor-associated mucin MUC1 are promising target structures for the development of antitumor vaccines. Because these endogenous structures were weakly immunogenic, they were coupled to immune-response-stimulating T-cell epitopes and the Pam3Cys lipopeptide to induce strong immune responses in mice. A new thioether-ligation method for the synthesis of two- and three-component vaccines that contain MUC1 glycopeptides as the B-cell epitopes, a T-cell epitope peptide, and the Pam3CSK4 lipopeptide is described. The resulting fully synthetic vaccines were used for the vaccination of mice, either in a liposome with Freund′s adjuvant or in aqueous PBS buffer. The three-component vaccines that contained the Tetanus Toxoid P2 T-cell epitope peptide induced strong immune responses, even when administered just in PBS. By activation of the complement-dependent cytotoxicity (CDC) complex, the antisera induced the killing of tumor cells.

Co-reporter:Jie Mao;Mei-Sha Chen;Yong-Xiang Chen
International Journal of Peptide Research and Therapeutics 2013 Volume 19( Issue 3) pp:185-189
Publication Date(Web):2013 September
DOI:10.1007/s10989-012-9329-5
Insulin assembly follows different pathways under different environments. But the mechanism of insulin assembly and the pathology of insulin-related amyloidosis diseases remain unclear. This work, illustrating different pathways of insulin aggregation induced by short peptide segment, may shed light on these research areas. We find that the short peptide segment LVEALYL (7aa, a segment of insulin B chain) can alter the pathway of insulin aggregation and induce the generation of highly toxic oligomers. However, when a bulky cyclen is attached to the peptide segment, β-sheet enriched fibrils will be formed again. This phenomenon may be induced by the disruptive effect of cyclen on the interaction between the short peptide and insulin, which alters the aggregation pathway.
Co-reporter:Zhi-Hua Huang ; Lei Shi ; Jing-Wen Ma ; Zhan-Yi Sun ; Hui Cai ; Yong-Xiang Chen ; Yu-Fen Zhao
Journal of the American Chemical Society 2012 Volume 134(Issue 21) pp:8730-8733
Publication Date(Web):May 15, 2012
DOI:10.1021/ja211725s
In the development of vaccines for epithelial tumors, the key targets are MUC1 proteins, which have a variable number of tandem repeats (VNTR) bearing tumor-associated carbohydrate antigens (TACAs), such as Tn and STn. A major obstacle in vaccine development is the low immunogenicity of the short MUC1 peptide. To overcome this obstacle, we designed, synthesized, and evaluated several totally synthetic self-adjuvanting vaccine candidates with self-assembly domains. These vaccine candidates aggregated into fibrils and displayed multivalent B-cell epitopes under mild conditions. Glycosylation of Tn antigen on the Thr residue of PDTRP sequence in MUC1 VNTR led to effective immune response. These vaccines elicited a high level antibody response without any adjuvant and induced antibodies that recognized human breast tumor cells. These vaccines appeared to act through a T-cell independent pathway and were associated with the activation of cytotoxic T cells. These fully synthetic, molecularly defined vaccine candidates had several features that hold promise for anticancer therapy.
Co-reporter:Peng Liu, Shuai Zhang, Mei-sha Chen, Qian Liu, Chenxuan Wang, Chen Wang, Yan-Mei Li, Flemming Besenbacher and Mingdong Dong  
Chemical Communications 2012 vol. 48(Issue 2) pp:191-193
Publication Date(Web):14 Oct 2011
DOI:10.1039/C1CC14285B
The pathogenesis of type II diabetes can be linked to cosecreted hIAPP/insulin interacting with cell membranes. Here we investigate the nanostructures by co-assembling hIAPP and insulin on surfaces. By tuning the hIAPP/insulin ratio, atomic force microscopy reveals the resulting nanostructure morphology changes from fibrils to oligomers, to annular. Implications for in vivo studies are discussed.
Co-reporter:Jing-Wen Ma, Lei Zhao, De-Sheng Zhao, Qian Liu, Chong Liu, Wei-Hui Wu, Yong-Xiang Chen, Yu-Fen Zhao and Yan-Mei Li  
Chemical Communications 2012 vol. 48(Issue 85) pp:10565-10567
Publication Date(Web):03 Sep 2012
DOI:10.1039/C2CC35178A
Lys16 is present in the core region of the amyloid β (Aβ) self-assembly in Alzheimer's disease. Here we report that the P9-NCS peptide can covalently react with Lys16 and inhibit Aβ neurotoxic fibrillization. Moreover P9-NCS has high selectivity and it cannot react with amylin, insulin, fetal bovine serum, Q11 and MUC1 peptide.
Co-reporter:Lei Zhao, Pei Tong, Yong-Xiang Chen, Zhi-Wen Hu, Kun Wang, Yu-Ning Zhang, De-Sheng Zhao, Li-Feng Cai, Ke-Liang Liu, Yu-Fen Zhao and Yan-Mei Li  
Organic & Biomolecular Chemistry 2012 vol. 10(Issue 32) pp:6512-6520
Publication Date(Web):14 Jun 2012
DOI:10.1039/C2OB25853F
HIV entry is mediated by the envelope glycoproteins gp120 and gp41. The gp41 subunit contains several functional domains: the N-terminal heptad repeat (NHR) domains fold a triple stranded coiled-coil forming a meta-stable prefusion intermediate. The C-terminal heptad repeat (CHR) subsequently folds onto the hydrophobic grooves of the NHR coiled-coil to form a stable 6-helix bundle, which juxtaposes the viral and cellular membranes for fusion. A conserved salt bridge between Lys574 in NHR and Asp632 in CHR plays an essential role in the formation of the six-helix bundle. A multi-functional peptide inhibitor for anti-HIV derived from the CHR of gp41 has been designed. It bears a cholesterol group (Chol) at the C-terminal through which the inhibitor can anchor in the cell membrane, and carries an isothiocyanate (NCS) group at the side chain of Asp632 through which the inhibitor can bind to target covalently at Lys574 in NHR. The dual functionalized peptide (NCS-C34-Chol) shows high antiviral activity in vitro and in vivo. The inhibitor reacts specifically and rapidly to NHR from gp41. In addition, it exhibits better stability under the digestion of the Proteinase K than C34 and T20.
Co-reporter:Hui Cai;Zhi-Hua Huang;Lei Shi;Zhan-Yi Sun;Dr. Yu-Fen Zhao;Dr. Horst Kunz;Dr. Yan-Mei Li
Angewandte Chemie International Edition 2012 Volume 51( Issue 7) pp:1719-1723
Publication Date(Web):
DOI:10.1002/anie.201106396
Co-reporter:Meisha Chen;Shuai Zhang;Qian Liu;Peng Liu;Dr. Katerina Busuttil; Chen Wang; Flemming Besenbacher;Dr. Yan-Mei Li;Dr. Mingdong Dong
Chemistry - A European Journal 2012 Volume 18( Issue 9) pp:2493-2497
Publication Date(Web):
DOI:10.1002/chem.201102215
Co-reporter:DeSheng Zhao;YongXiang Chen;Qian Liu;YuFen Zhao;YanMei Li
Science China Chemistry 2012 Volume 55( Issue 1) pp:112-117
Publication Date(Web):2012 January
DOI:10.1007/s11426-011-4451-3
Using blind dock method, we find that thioflavin-T (ThT) can bind to both monomers and fibrils of the full-length β-amyloid peptide (Aβ1-42) and has a higher binding affinity to the fibrils. It is shown that the hydrophobic interaction between the ligand (ThT) and substrate (Aβ1-42) are stronger than hydrogen bonds. Furthermore, ThT tends to be located near the C-terminus of Aβ monomer through hydrophobic and electrostatic interactions, while it tends to contact the residues Met35 and Gly27 of the fibril surface mainly through hydrophobic interaction. Finally, according to the docking results and ThT fluorescence assay, a kinetic equation is proposed to deduce the aggregation rate coefficient of Aβ1-42.
Co-reporter:Lu Jin, Wei-Hui Wu, Qiu-Ye Li, Yu-Fen Zhao and Yan-Mei Li  
Nanoscale 2011 vol. 3(Issue 11) pp:4746-4751
Publication Date(Web):26 Sep 2011
DOI:10.1039/C1NR11029B
Copper is known to be a critical factor in Alzheimer's disease (AD) pathogenesis, as it is involved in amyloid-β (Aβ) peptide related toxicity. However, the relationship between neurotoxicity and Aβ peptide in the presence of copper remains unclear. The effect of copper has not been clearly differentiated between Aβ42 and Aβ40, and it is still debated whether copper-mediated neurotoxicity is due to reactive oxygen species (ROS) accumulation or other molecular mechanisms. Here, we describe that copper dramatically affects Aβ42 aggregation and enhances Aβ42 cytotoxicity while it shows no significant effects on Aβ40. These phenomena are mainly because that the strong interactions between copper and Aβ42 lead to great conformation changes, and stabilize Aβ42 aggregates at highly toxic nanoscale oligomer stage, whereas copper shows no similar impact on Aβ40. We also propose a possible molecular mechanism that copper enhances Aβ42 cytotoxicity via perturbing membrane structure. Moreover, we test the effect of an analogue of copper, nickel, on Aβ aggregation and cytotoxicity, finding that nickel also enhances cytotoxicity viaAβ42 nanoscale oligomer formation. These results clarify that the copper-induced Aβ42 nanoscale oligomer formation is the key process for Aβ neurotoxicity, and suggest that disrupting the interactions between copper and Aβ42 peptide to inhibit nanoscale oligomerization process, deserves more attention in AD drug development.
Co-reporter:Qian Liu, Wei-hui Wu, Chuan-lin Fang, Ren-wang Li, Peng Liu, Peng Lei, Jia Hu, Xun Sun, Yi-zhe Zheng, Yu-fen Zhao and Yan-mei Li  
Molecular BioSystems 2011 vol. 7(Issue 5) pp:1693-1700
Publication Date(Web):16 Mar 2011
DOI:10.1039/C1MB05019B
Blocking the interaction between the E4 isoform of apolipoprotein E (ApoE) and amyloid beta-peptide (Aβ) may be an avenue for pharmacological intervention in Alzheimer's disease (AD). The main regions of interaction of the two proteins are, respectively, ApoE244–272 and Aβ12–28. These protein segments are too large to facilitate the design of small molecule inhibitors. We mapped the primary components of ApoE/Aβ interaction to smaller peptide segments. Within the three motifs that are primarily responsible for ApoE/Aβ interaction, we identified four peptides that substantially block ApoE/Aβ interaction and further improved their inhibitory activity by rational hydrophobic amino acid substitution. Moreover, the mapping results provide the clue that the Aβ residues which interact with ApoE appear to be in the same region where Aβ self-interacts. According to this information, we found that Congo Red and X-34 could strongly inhibit ApoE/Aβ interaction. Our findings extend our understanding of ApoE/Aβ interaction and may guide the discovery of inhibitors that treat AD by antagonizing ApoE/Aβ interaction.
Co-reporter:Hui Cai;Zhi-Hua Huang;Lei Shi;Dr. Yu-Fen Zhao;Dr. Horst Kunz;Dr. Yan-Mei Li
Chemistry - A European Journal 2011 Volume 17( Issue 23) pp:6396-6406
Publication Date(Web):
DOI:10.1002/chem.201100217

Abstract

The membrane-bound tumor-associated glycoprotein MUC1 is aberrantly glycosylated in cancer cells compared with normal cells, and is therefore considered an attractive target for cancer immunotherapy. However, tumor-associated glycopeptides from MUC1 do not elicit a sufficiently robust immune response. Therefore, antitumor vaccines were developed, which consist of MUC1 glycopeptides as the B epitopes and immune-stimulating toll-like receptor 2 (TLR 2) lipopeptide ligands. These fully synthetic vaccine candidates were prepared by solid-phase synthesis of the MUC1 glycopeptides. The Pam3Cys lipopeptide, also synthesized on solid-phase, was C-terminally coupled to oligovalent lysine cores, which N-terminally incorporate O-propargyl oligoethylene glycol acyl side chains. The MUC1 glycopeptides and lipopeptide lysine constructs were then conjugated by click chemistry to give oligovalent synthetic vaccines. Oligovalent glycopeptide–lipopeptide conjugates are considered more immunogenic than their monovalent analogues.

Co-reporter:Ye-Ping Yu, Peng Lei, Jia Hu, Wei-Hui Wu, Yu-Fen Zhao and Yan-Mei Li  
Chemical Communications 2010 vol. 46(Issue 37) pp:6909-6911
Publication Date(Web):23 Aug 2010
DOI:10.1039/C0CC02141E
Copper enhances amyloid cytotoxicity and mediates human islet amyloid polypeptide (hIAPP) oligomerization; nickel, a redox inactive metal with similar protein binding affinity to copper, also mimics this effect, thereby demonstrating copper-mediated hIAPP cytotoxicity is due mainly to granular oligomer generation rather than ROS accumulation in type 2 diabetes.
Co-reporter:Jia Hu, Ye-Ping Yu, Wei Cui, Chuan-Lin Fang, Wei-Hui Wu, Yu-Fen Zhao and Yan-Mei Li  
Chemical Communications 2010 vol. 46(Issue 42) pp:8023-8025
Publication Date(Web):21 Sep 2010
DOI:10.1039/C0CC02555K
Human islet amyloid polypeptide (hIAPP) deposit is the hallmark of type 2 diabetes pathology. Here, we report that apo-cyclen, attached to a specific hIAPP recognition motif (NYGAIL), captured copper ions and became proteolytically active. This cyclen-NYGAIL-copper complex was able to interfere with hIAPP aggregation and cleave hIAPP. These activities rescued INS-1 cells from hIAPP induced cytotoxicity.
Co-reporter:Yong-Xiang Chen, Lei Zhao, Zhi-Ping Huang, Yu-Fen Zhao, Yan-Mei Li
Bioorganic & Medicinal Chemistry Letters 2009 Volume 19(Issue 14) pp:3775-3778
Publication Date(Web):15 July 2009
DOI:10.1016/j.bmcl.2009.04.090
A facile synthesis of cyclopeptide-centered multivalent glycoclusters using Cu(I) catalyzed Huisgen 1,3-dipolar cycloaddition of azides and terminal alkynes, so called ‘click chemistry’, has been developed. The affinities of mannose-specific protein Concanavalin A (Con A) toward two synthetic glycoclusters respectively bearing divalent or tetravalent mannoses were investigated by surface plasmon resonance (SPR). It is founded that the tetravalent glycocluster has 3.0-fold increase in binding affinity relative to the divalent glycoluster (valency-corrected values), which indicates the potential of this system in investigating carbohydrate–protein interactions.A facile synthesis of cyclopeptide-centered multivalent glycoclusters using Cu(I) catalyzed Huisgen 1,3-dipolar cycloaddition of azides and terminal alkynes, so called ‘click chemistry’, has been developed. The affinities of mannose-specific protein Concanavalin A (Con A) toward two synthetic glycoclusters respectively bearing divalent or tetravalent mannoses were investigated by surface plasmon resonance.
Co-reporter:Yong-Xiang Chen, Jin-Tang Du, Lian-Xiu Zhou, Xiao-Hong Liu, Yu-Fen Zhao, Hiroshi Nakanishi, Yan-Mei Li
Chemistry & Biology 2006 Volume 13(Issue 9) pp:937-944
Publication Date(Web):September 2006
DOI:10.1016/j.chembiol.2006.06.017
Serine and threonine residues in many proteins can be modified by either phosphorylation or GlcNAcylation. To investigate the mechanism of O-GlcNAc and O-phosphate's reciprocal roles in modulating the degradation and activity of murine estrogen receptor β (mER-β), the conformational changes induced by O-GlcNAcylation and O-phosphorylation of Ser16 in 17-mer model peptides corresponding to the N-terminal intrinsically disordered (ID) region of mER-β were studied by NMR techniques, circular dichroism (CD), and molecular dynamics simulations. Our results suggest that O-phosphorylation discourages the turn formation in the S15STG18 fragment. In contrast, O-GlcNAcylation promotes turn formation in this region. Thus, we postulate that the different changes of the local structure in the N-terminal S15STG18 fragment of mER-β caused by O-phosphate or O-GlcNAc modification might lead to the disturbances to the dynamic ensembles of the ID region of mER-β, which is related to its modulatory activity.
Co-reporter:Qing-Feng Ma;Jia Hu;Wei-Hui Wu;Hua-Dong Liu;Jin-Tang Du;Yuan Fu;Yong-Wei Wu;Peng Lei;Yu-Fen Zhao
Biopolymers 2006 Volume 83(Issue 1) pp:
Publication Date(Web):13 APR 2006
DOI:10.1002/bip.20523

Amyloid-β peptide (Aβ) is the principal constituent of plaques associated with Alzheimer's disease (AD) and is thought to be responsible for the neurotoxicity associated with the disease. Copper binding to Aβ has been hypothesized to play an important role in the neruotoxicity of Aβ and free radical damage, and Cu2+ chelators represent a possible therapy for AD. However, many properties of copper binding to Aβ have not been elucidated clearly, and the location of copper binding sites on Aβ is also in controversy. Here we have used a range of spectroscopic techniques to characterize the coordination of Cu2+ to Aβ(1–16) in solution. Electrospray ionization mass spectrometry shows that copper binds to Aβ(1–16) at pH 6.0 and 7.0. The mode of copper binding is highly pH dependent. Circular dichroism results indicate that copper chelation causes a structural transition of Aβ(1–16). UV-visible absorption spectra suggest that three nitrogen donor ligands and one oxygen donor ligand (3N1O) in Aβ(1–16) may form a type II square-planar coordination geometry with Cu2+. By means of fluorescence spectroscopy, competition studies with glycine and L-histidine show that copper binds to Aβ(1–16) with an affinity of Ka ∼ 107M–1 at pH 7.8. Besides His6, His13, and His14, Tyr10 is also involved in the coordination of Aβ(1–16) with Cu2+, which is supported by 1H NMR and UV-visible absorption spectra. Evidence for the link between Cu2+ and AD is growing, and this work has made a significant contribution to understanding the mode of copper binding to Aβ(1–16) in solution. © 2006 Wiley Periodicals, Inc. Biopolymers 83: 20–31, 2006

This article was originally published online as an accepted preprint. The “Published Online” date corresponds to the preprint version. You can request a copy of the preprint by emailing the Biopolymers editorial office at biopolymers@wiley.com

Co-reporter:Qing-Feng Ma;Jin-Tang Du;Kenji Kanazawa;Tadashi Nemoto;Hiroshi Nakanishi;Yu-Fen Zhao
Biopolymers 2005 Volume 79(Issue 2) pp:
Publication Date(Web):29 JUN 2005
DOI:10.1002/bip.20335

The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the α-sheet structure favors aberrant protein aggregates. However, some reports have shown that the α-helix structure is capable of triggering the formation of aberrant tau protein aggregates and PHFs have a high α-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306–336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318–335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, α-helices, and β-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mol eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a β-sheet structure forms in the presence of 1 mol eq of Cu2+. As α-helix and β-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. © 2005 Wiley Periodicals, Inc. Biopolymers 79: 74–85, 2005

This article was originally published online as an accepted preprint. The “Published Online” date corresponds to the preprint version. You can request a copy of the preprint by emailing the Biopolymers editorial office at biopolymers@wiley.com

Co-reporter:Chuan-Lin Fang, Wei-Hui Wu, Qian Liu, Xun Sun, ... Yan-Mei Li
Regulatory Peptides (9 August 2010) Volume 163(Issues 1–3) pp:1-6
Publication Date(Web):9 August 2010
DOI:10.1016/j.regpep.2010.05.001
Amyloid-β (Aβ) aggregation and Cu(II)-related oxidative stress are involved in the dysfunction and death of neurons in Alzheimer's disease (AD). However, the relationship between Aβ and Cu(II) is not clear. Furthermore, the pro- or anti-oxidant properties of Aβ are also under great debate. Here the H2O2 generating ability of Aβ42 in its monomeric, oligomeric and fibrillar forms was studied in the presence of Cu(II). The results show that Aβ42 in both oligomeric and fibrillar forms can promote H2O2 generation at lower concentrations of Cu(II) and Aβ42 oligomer can promote H2O2 generation to a higher extent. Nevertheless, the promoting effect of Aβ42 oligomer and fibril may convert to an inhibitory effect when the concentration of Cu(II) is increased. This indicates the dual functions of Aβ42 oligomer and fibril in Cu(II)-induced H2O2 production. Hereby we present a new perspective on the roles of Aβ42 in Cu(II)-mediated oxidative stress and add new evidence to the viewpoint that Aβ42 oligomer may be primarily responsible for the pathogenesis of AD.
Co-reporter:Wei-Qun Shi, Hui Cai, Dian-Dou Xu, Xiao-Yang Su, ... Yan-Mei Li
Regulatory Peptides (1 December 2007) Volume 144(Issues 1–3) pp:1-5
Publication Date(Web):1 December 2007
DOI:10.1016/j.regpep.2007.06.011
Proteins are targets of reactive nitrogen species such as peroxynitrite and nitrogen dioxide. Among the various amino acids in proteins, tyrosine and tryptophan residues are especially susceptible to attack by reactive nitrogen species. On the other hand, protein tyrosine phosphorylation has gained much attention in respect to cellular regulatory events and signal transduction. Peroxynitrite-mediated nitration of peptide YPPPPPW and phosphopeptide pYPPPPPW were studied at pH 7.4. The predominant nitrated products were separated and identified by reverse phase high performance liquid chromatography coupled with electrospray ionization mass spectrometry (LC-MS). The nitration sites were established by tandem electrospray ionization-mass spectrometry (LC-MS/MS). A regulatory effect of tyrosine phosphorylation/dephosphorylation on peptide nitration was observed. YPPPPPW was predominantly nitrated at tyrosine residue while pYPPPPPW was nitrated at tryptophan one. Our results can help in understanding the biochemical significance of the relationship of tyrosine phosphorylation and nitration in proteins.
Co-reporter:Z. Y. Sun, P. G. Chen, Y. F. Liu, B. D. Zhang, J. J. Wu, Y. X. Chen, Y. F. Zhao and Y. M. Li
Chemical Communications 2016 - vol. 52(Issue 48) pp:NaN7575-7575
Publication Date(Web):2016/05/17
DOI:10.1039/C6CC02000C
Novel multi-component self-assembled nano-vaccines containing both Pam3CSK4 and CpG were developed for the first time. These multi-component vaccines could effectively activate the macrophages in vitro and elicit strong antibody immune responses and anti-tumor immune responses in vivo.
Co-reporter:Mei-Sha Chen, De-Sheng Zhao, Ye-Ping Yu, Wei-Wei Li, Yong-Xiang Chen, Yu-Fen Zhao and Yan-Mei Li
Chemical Communications 2013 - vol. 49(Issue 18) pp:NaN1801-1801
Publication Date(Web):2012/11/02
DOI:10.1039/C2CC33432A
The differences in the C-terminal domains of human amylin peptide variants initiate different aggregation processes and differences in the composition of the aggregates by affecting the hydrophobic cores, conformations, and intra-sheet interactions of the peptides, which have distinct effects on the cytotoxicity of the peptides.
Co-reporter:De-Sheng Zhao, Yong-Xiang Chen and Yan-Mei Li
Chemical Communications 2015 - vol. 51(Issue 11) pp:NaN2098-2098
Publication Date(Web):2014/12/15
DOI:10.1039/C4CC06739H
Developing compounds regulating amyloid toxic oligomer but not fibril formation should constitute an effective strategy for the treatment of diabetes. Based on the full understanding of the folding mechanism, we designed an orthosteric helix regulator that can promote hIAPP to assemble into large non-cytotoxic oligomers. As a result, the islet cells were protected.
Co-reporter:Jing-Wen Ma, Lei Zhao, De-Sheng Zhao, Qian Liu, Chong Liu, Wei-Hui Wu, Yong-Xiang Chen, Yu-Fen Zhao and Yan-Mei Li
Chemical Communications 2012 - vol. 48(Issue 85) pp:NaN10567-10567
Publication Date(Web):2012/09/03
DOI:10.1039/C2CC35178A
Lys16 is present in the core region of the amyloid β (Aβ) self-assembly in Alzheimer's disease. Here we report that the P9-NCS peptide can covalently react with Lys16 and inhibit Aβ neurotoxic fibrillization. Moreover P9-NCS has high selectivity and it cannot react with amylin, insulin, fetal bovine serum, Q11 and MUC1 peptide.
Co-reporter:Peng Liu, Shuai Zhang, Mei-sha Chen, Qian Liu, Chenxuan Wang, Chen Wang, Yan-Mei Li, Flemming Besenbacher and Mingdong Dong
Chemical Communications 2012 - vol. 48(Issue 2) pp:NaN193-193
Publication Date(Web):2011/10/14
DOI:10.1039/C1CC14285B
The pathogenesis of type II diabetes can be linked to cosecreted hIAPP/insulin interacting with cell membranes. Here we investigate the nanostructures by co-assembling hIAPP and insulin on surfaces. By tuning the hIAPP/insulin ratio, atomic force microscopy reveals the resulting nanostructure morphology changes from fibrils to oligomers, to annular. Implications for in vivo studies are discussed.
Co-reporter:Jia Hu, Ye-Ping Yu, Wei Cui, Chuan-Lin Fang, Wei-Hui Wu, Yu-Fen Zhao and Yan-Mei Li
Chemical Communications 2010 - vol. 46(Issue 42) pp:NaN8025-8025
Publication Date(Web):2010/09/21
DOI:10.1039/C0CC02555K
Human islet amyloid polypeptide (hIAPP) deposit is the hallmark of type 2 diabetes pathology. Here, we report that apo-cyclen, attached to a specific hIAPP recognition motif (NYGAIL), captured copper ions and became proteolytically active. This cyclen-NYGAIL-copper complex was able to interfere with hIAPP aggregation and cleave hIAPP. These activities rescued INS-1 cells from hIAPP induced cytotoxicity.
Co-reporter:Ye-Ping Yu, Peng Lei, Jia Hu, Wei-Hui Wu, Yu-Fen Zhao and Yan-Mei Li
Chemical Communications 2010 - vol. 46(Issue 37) pp:NaN6911-6911
Publication Date(Web):2010/08/23
DOI:10.1039/C0CC02141E
Copper enhances amyloid cytotoxicity and mediates human islet amyloid polypeptide (hIAPP) oligomerization; nickel, a redox inactive metal with similar protein binding affinity to copper, also mimics this effect, thereby demonstrating copper-mediated hIAPP cytotoxicity is due mainly to granular oligomer generation rather than ROS accumulation in type 2 diabetes.
Co-reporter:Lei Zhao, Pei Tong, Yong-Xiang Chen, Zhi-Wen Hu, Kun Wang, Yu-Ning Zhang, De-Sheng Zhao, Li-Feng Cai, Ke-Liang Liu, Yu-Fen Zhao and Yan-Mei Li
Organic & Biomolecular Chemistry 2012 - vol. 10(Issue 32) pp:NaN6520-6520
Publication Date(Web):2012/06/14
DOI:10.1039/C2OB25853F
HIV entry is mediated by the envelope glycoproteins gp120 and gp41. The gp41 subunit contains several functional domains: the N-terminal heptad repeat (NHR) domains fold a triple stranded coiled-coil forming a meta-stable prefusion intermediate. The C-terminal heptad repeat (CHR) subsequently folds onto the hydrophobic grooves of the NHR coiled-coil to form a stable 6-helix bundle, which juxtaposes the viral and cellular membranes for fusion. A conserved salt bridge between Lys574 in NHR and Asp632 in CHR plays an essential role in the formation of the six-helix bundle. A multi-functional peptide inhibitor for anti-HIV derived from the CHR of gp41 has been designed. It bears a cholesterol group (Chol) at the C-terminal through which the inhibitor can anchor in the cell membrane, and carries an isothiocyanate (NCS) group at the side chain of Asp632 through which the inhibitor can bind to target covalently at Lys574 in NHR. The dual functionalized peptide (NCS-C34-Chol) shows high antiviral activity in vitro and in vivo. The inhibitor reacts specifically and rapidly to NHR from gp41. In addition, it exhibits better stability under the digestion of the Proteinase K than C34 and T20.
L-Serine, N-[bis(1-methylethoxy)phosphinyl]-L-seryl-
L-Alanine, N-[bis(hexadecyloxy)phosphinyl]-L-alanyl-
Glycine, N-glycyl-, butyl ester
L-Cysteine, butyl ester
L-Aspartic acid, N-[bis(1-methylethoxy)phosphinyl]-, 1-butyl ester
L-Aspartic acid, N-[butoxy(1-methylethoxy)phosphinyl]-, dibutyl ester
L-Aspartic acid, N-(diethoxyphosphinyl)-
L-Tyrosine, N-[1-[1-(dibutoxyphosphinyl)-L-prolyl]-L-prolyl]-, methyl ester
L-Glutamic acid, N-(diethoxyphosphinyl)-
Glycine, N-[bis(1-methylethoxy)phosphinyl]-L-seryl-